PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g003480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 781aa    MW: 85609.2 Da    PI: 6.7145
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g003480.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85e-2096151156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe +F+++++p++++r +L+++l+L+ +qVk+WFqNrR+++k
  Csa05g003480.1  96 KKRYHRHTPQQIQELELVFKECPHPDEKQRLDLSRRLNLDSQQVKFWFQNRRTQMK 151
                     688999***********************************************999 PP

2START177.38.9e-563005291206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+ + +ep+W  ss    e++n++e+ ++f++  +     + +ea++++g+v+ ++  lve+l+d+  +W e+++    + +t 
  Csa05g003480.1 300 ELALSAMDELVKMTQTSEPLWIPSSkgkgEMLNREEYEKIFTPCLGpkpdgFVSEASKEVGMVIINSLALVETLMDSE-RWAEMFPcmiaRNSTS 393
                     57899************************************98766999999**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEEE CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskvt 165
                     e is g      gal+lm+aelq+lsplvp R ++f+R+++q+ +g+w++vdvSvd  +++       s+ +  +++lp+g+l+++++ng+skvt
  Csa05g003480.1 394 EIISRGmggtrnGALYLMQAELQLLSPLVPvRQVTFLRFCKQHAEGVWAVVDVSVDRISDRVGsasaqSQTSLSCRRLPTGCLVQDMPNGYSKVT 488
                     ********************************************************999988777777888999********************* PP

                     EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     w++h+++++ ++h l+rslv+sgla+g k+w ++lqrqce+
  Csa05g003480.1 489 WIDHTEYDDTHIHHLYRSLVSSGLAFGSKRWISALQRQCES 529
                     ***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1981153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-2087153IPR009057Homeodomain-like
PROSITE profilePS5007117.03893153IPR001356Homeobox domain
SMARTSM003899.5E-1894157IPR001356Homeobox domain
PfamPF000461.4E-1796151IPR001356Homeobox domain
CDDcd000863.45E-1796153No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
PROSITE profilePS5084841.584291532IPR002913START domain
SuperFamilySSF559617.97E-29294529No hitNo description
CDDcd088754.76E-113295528No hitNo description
SMARTSM002341.1E-42300529IPR002913START domain
PfamPF018523.7E-48300529IPR002913START domain
SuperFamilySSF559611.04E-19557772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MNFSGFLHHD DNKSSGGGND FSSAAMSGGG SLVKSIFSSP RLSLGLQTNG EATRTGESFE  60
VSVSRRSPES RSGSDNAEAL SGDDDFDASD RPLKKKKRYH RHTPQQIQEL ELVFKECPHP  120
DEKQRLDLSR RLNLDSQQVK FWFQNRRTQM KTQIERHENS LLRQENDKLR AENMSAREAI  180
RNPMCGHCGG AAVLGEISLE EHHLRIENSR LKDELDRICA LAGKFINRSD DDATGSHNLL  240
PNSALQLGVG TKNGYGGGGF TLVPPAGFEI SSPFFSGIVA PVNRATDVGT GLDQKSLYLE  300
LALSAMDELV KMTQTSEPLW IPSSKGKGEM LNREEYEKIF TPCLGPKPDG FVSEASKEVG  360
MVIINSLALV ETLMDSERWA EMFPCMIARN STSEIISRGM GGTRNGALYL MQAELQLLSP  420
LVPVRQVTFL RFCKQHAEGV WAVVDVSVDR ISDRVGSASA QSQTSLSCRR LPTGCLVQDM  480
PNGYSKVTWI DHTEYDDTHI HHLYRSLVSS GLAFGSKRWI SALQRQCESL TILMSSAIPN  540
RDKPTPISSI GKKSMLKLAQ RMTQKFCRGV CASSSQKWSK LEIGNIDEDV RIMTGKNMDD  600
SGEPPGILLS AATSVWIPVP PRRLFDFLRD VLLRSEWDIL SNGGPMQEIA NIFKGQDQSN  660
SVSLLRSTAM NANQSSMLIL QETSIDASGA VVVYAPVDIP AMHSVMKGAD SAYVALLPSG  720
FGILPDGQGM EETGSLLTVA FQILVNSLPT AKLNVESIET VNNLISCTIQ KIRAALRCDK  780
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010508115.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X2
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FVJ90.0R0FVJ9_9BRAS; Uncharacterized protein
STRINGBra004934.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1